PDB entry 1jfz

View 1jfz on RCSB PDB site
Description: Crystal Structure of MN(II)-Complex of RNAse III Endonuclease Domain from Aquifex Aeolicus at 2.10 Angstrom Resolution
Class: hydrolase
Keywords: ribonuclease, RNAse III, double-stranded RNA, RNA interference, endonuclease domain, endonucleolytic cleavage
Deposited on 2001-06-22, released 2001-12-19
The last revision prior to the SCOP 1.73 freeze date was dated 2001-12-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082
      • see remark 999 (0)
    Domains in SCOP 1.73: d1jfza_
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082
      • see remark 999 (0)
      • his tag (148)
    Domains in SCOP 1.73: d1jfzb_
  • Chain 'C':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082
      • see remark 999 (0)
      • his tag (148)
    Domains in SCOP 1.73: d1jfzc_
  • Chain 'D':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082 (1-147)
      • see remark 999 (0)
    Domains in SCOP 1.73: d1jfzd_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jfzA (A:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfzA (A:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jfzB (B:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfzB (B:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jfzC (C:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfzC (C:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jfzD (D:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfzD (D:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegr