PDB entry 1jft

View 1jft on RCSB PDB site
Description: purine repressor mutant-hypoxanthine-purf operator complex
Class: transcription/DNA
Keywords: transcription regulation, DNA-binding, repressor, purine biosynthesis, complex (DNA-binding protein/DNA), allosteric regulation, transcription/DNA complex
Deposited on 2001-06-21, released 2002-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleotide synthesis repressor
    Species: Escherichia coli [TaxId:562]
    Gene: PURR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACP7 (0-339)
      • engineered (145)
    Domains in SCOPe 2.06: d1jfta1, d1jfta2
  • Chain 'B':
    Compound: 5'-d(*tp*ap*cp*gp*cp*ap*ap*ap*cp*gp*tp*tp*tp*gp*cp*gp*t)-3'
  • Heterogens: PO4, HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jftA (A:)
    atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnhtks
    igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
    mcseypepllamleeyrhipmvvmdageakadftdavidnafeggymagrylierghrei
    gvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
    avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
    fnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

  • Chain 'B':
    No sequence available.