PDB entry 1jfq

View 1jfq on RCSB PDB site
Description:
Deposited on 2001-06-21, released 2002-02-27
The last revision prior to the SCOP 1.65 freeze date was dated 2002-02-27, with a file datestamp of 2002-02-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1jfqh1, d1jfqh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1jfql1, d1jfql2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jfqH (H:)
    evqlqqsgvelvragssvkmsckasgytftsnginwvkqrpgqglewigynnpgngyity
    nekfkgkttltvdkssntaymqlrsltsedsavyfcarseyyggsykfdywgqgttltvs
    sagttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfqH (H:)
    vqlqqsgvelvragssvkmsckasgytftsnginwvkqrpgqglewigynnpgngyityn
    ekfkgkttltvdkssntaymqlrsltsedsavyfcarseyyggsykfdywgqgttltvss
    agttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfqL (L:)
    diqmtqipsslsaslgdrvsiscrasqdinnflnwyqqkpdgtiklliyftsrsqsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgnalprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrneca