PDB entry 1jfq

View 1jfq on RCSB PDB site
Description: antigen-binding fragment of the murine anti-phenylarsonate antibody 36-71, "fab 36-71"
Class: immune system
Keywords: immunoglobulin, IMMUNE SYSTEM
Deposited on 2001-06-21, released 2002-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antigen-binding fragment of anti-phenylarsonate antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jfqh1, d1jfqh2
  • Chain 'L':
    Compound: antigen-binding fragment of anti-phenylarsonate antibody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jfql1, d1jfql2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jfqH (H:)
    evqlqqsgvelvragssvkmsckasgytftsnginwvkqrpgqglewigynnpgngyity
    nekfkgkttltvdkssntaymqlrsltsedsavyfcarseyyggsykfdywgqgttltvs
    sagttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfqH (H:)
    vqlqqsgvelvragssvkmsckasgytftsnginwvkqrpgqglewigynnpgngyityn
    ekfkgkttltvdkssntaymqlrsltsedsavyfcarseyyggsykfdywgqgttltvss
    agttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfqL (L:)
    diqmtqipsslsaslgdrvsiscrasqdinnflnwyqqkpdgtiklliyftsrsqsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgnalprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrneca