PDB entry 1jfo

View 1jfo on RCSB PDB site
Description: crystal structure of the bifunctional inhibitor ragi
Deposited on 1997-06-21, released 1997-12-24
The last revision was dated 1997-12-24, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.192
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1jfo_ (-)
svgtscipgmaiphnpldscrwyvstrtcgvgprlatqemkarccrqleaipaycrceav
rilmdgvvtpsgqhegrllqdlpgcprqvqrafapklvtevecnlatihggpfclsllga
ge

  • Chain 'p':
    No sequence available.