PDB entry 1jfn

View 1jfn on RCSB PDB site
Description: solution structure of human apolipoprotein(a) kringle IV type 6
Class: lipid transport
Keywords: kringle domain, protein-protein recognition, Lp(a), LIPID TRANSPORT
Deposited on 2001-06-21, released 2002-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein a, kiv-t6
    Species: Homo sapiens [TaxId:9606]
    Gene: APOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08519 (13-118)
      • expression tag (0-12)
    Domains in SCOPe 2.06: d1jfna1, d1jfna2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jfnA (A:)
arihhhhhhiegrapteqspgvqdcyhgdgqsyrgsfsttvtgrtcqswssmtphwhqrt
teyypnggltrnycrnpdaeispwcytmdpnvrweycnltqcpvtessvlatstavseq