PDB entry 1jfn

View 1jfn on RCSB PDB site
Description: solution structure of human apolipoprotein(a) kringle iv type 6
Deposited on 2001-06-21, released 2002-06-28
The last revision prior to the SCOP 1.67 freeze date was dated 2002-06-28, with a file datestamp of 2002-06-28.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1jfna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfnA (A:)
    arihhhhhhiegrapteqspgvqdcyhgdgqsyrgsfsttvtgrtcqswssmtphwhqrt
    teyypnggltrnycrnpdaeispwcytmdpnvrweycnltqcpvtessvlatstavseq