PDB entry 1jfm

View 1jfm on RCSB PDB site
Description:
Deposited on 2001-06-21, released 2002-02-20
The last revision prior to the SCOP 1.63 freeze date was dated 2002-02-20, with a file datestamp of 2002-02-20.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.234
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1jfma_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1jfmb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1jfmc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1jfmd_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1jfme_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfmA (A:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfmB (B:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfmC (C:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfmD (D:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfmE (E:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek