PDB entry 1jfm

View 1jfm on RCSB PDB site
Description: crystal structure of murine nk cell ligand rae-1 beta
Class: immune system
Keywords: murine nk cell ligand, rae-1 beta, nkg2d, MHC-I platform, immune system
Deposited on 2001-06-21, released 2002-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.234
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinoic acid early transcript beta
    Species: Mus musculus [TaxId:10090]
    Gene: RAE-1beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jfma_
  • Chain 'B':
    Compound: retinoic acid early transcript beta
    Species: Mus musculus [TaxId:10090]
    Gene: RAE-1beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jfmb_
  • Chain 'C':
    Compound: retinoic acid early transcript beta
    Species: Mus musculus [TaxId:10090]
    Gene: RAE-1beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jfmc_
  • Chain 'D':
    Compound: retinoic acid early transcript beta
    Species: Mus musculus [TaxId:10090]
    Gene: RAE-1beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jfmd_
  • Chain 'E':
    Compound: retinoic acid early transcript beta
    Species: Mus musculus [TaxId:10090]
    Gene: RAE-1beta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jfme_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfmA (A:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfmB (B:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfmC (C:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfmD (D:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfmE (E:)
    dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
    ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
    tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek