PDB entry 1jfi

View 1jfi on RCSB PDB site
Description: crystal structure of the nc2-tbp-dna ternary complex
Deposited on 2001-06-20, released 2001-07-11
The last revision prior to the SCOP 1.67 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jfiA (A:)
    mpskkkkynarfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsr
    naktmttshlkqcielegdpaankarkeaelaaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfiA (A:)
    arfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsrtmttshlkq
    cie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jfiB (B:)
    gphmasssgndddltipraainkmiketlpnvrvandarelvvncctefihlisseanei
    cnksekktispehviqaleslgfgsyisevkevlqecktvalkrrkassrlenlgipeee
    llrqqqelfakarqqqaelaqqewlqmqqaaqqaqlaaasasasnqagssqdeeddddi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfiB (B:)
    ddltipraainkmiketlpnvrvandarelvvncctefihlisseaneicnksekktisp
    ehviqaleslgfgsyisevkevlqecktvalkrrkassrlenlgipeeellrqqqelfak
    arqqqaelaqqewlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jfiC (C:)
    gshmsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalif
    ssgkmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglv
    lthqqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkg
    frktt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfiC (C:)
    shmsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifs
    sgkmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvl
    thqqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgf
    rkt