PDB entry 1jfi

View 1jfi on RCSB PDB site
Description: Crystal Structure of the NC2-TBP-DNA Ternary Complex
Class: transcription/DNA
Keywords: Histone, H2A/H2B, TBP, TATA-DNA, transcription initiation, NC2, Negative Cofactor, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSCRIPTION/DNA COMPLEX
Deposited on 2001-06-20, released 2001-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.233
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription Regulator NC2 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: NC2 alpha (DRAP1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jfia_
  • Chain 'B':
    Compound: Transcription Regulator NC2 beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: NC2 beta (Dr1)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jfib_
  • Chain 'C':
    Compound: tata-box-binding protein (tbp)
    Species: Homo sapiens [TaxId:9606]
    Gene: tbp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20226 (4-End)
      • cloning artifact (1-3)
    Domains in SCOPe 2.07: d1jfic1, d1jfic2, d1jfic3
  • Chain 'D':
    Compound: 5'-d(*tp*tp*gp*gp*cp*tp*ap*tp*ap*ap*ap*ap*gp*gp*gp*cp*tp*cp*c)-3'
  • Chain 'E':
    Compound: 5'-d(*g*gp*ap*gp*cp*cp*cp*tp*tp*tp*tp*ap*tp*ap*gp*cp*cp*ap*a)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jfiA (A:)
    mpskkkkynarfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsr
    naktmttshlkqcielegdpaankarkeaelaaataeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfiA (A:)
    arfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsrtmttshlkq
    cie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jfiB (B:)
    gphmasssgndddltipraainkmiketlpnvrvandarelvvncctefihlisseanei
    cnksekktispehviqaleslgfgsyisevkevlqecktvalkrrkassrlenlgipeee
    llrqqqelfakarqqqaelaqqewlqmqqaaqqaqlaaasasasnqagssqdeeddddi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfiB (B:)
    ddltipraainkmiketlpnvrvandarelvvncctefihlisseaneicnksekktisp
    ehviqaleslgfgsyisevkevlqecktvalkrrkassrlenlgipeeellrqqqelfak
    arqqqaelaqqewlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jfiC (C:)
    gshmsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalif
    ssgkmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglv
    lthqqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkg
    frktt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jfiC (C:)
    shmsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifs
    sgkmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvl
    thqqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgf
    rkt
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.