PDB entry 1jfh

View 1jfh on RCSB PDB site
Description: structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution
Class: hydrolase
Keywords: hydrolase, o-glycosyl, alpha-amylase, methyl 4,4'-dithio-alpha-maltotrioside
Deposited on 1997-09-19, released 1998-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.16
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00690 (1-495)
      • conflict (48)
      • conflict (242)
      • conflict (309)
      • conflict (322)
    Domains in SCOPe 2.07: d1jfha1, d1jfha2
  • Heterogens: MA2, MA3, GLC, MA1, CL, HG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jfhA (A:)
    eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenvvvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgepfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl