PDB entry 1jff

View 1jff on RCSB PDB site
Description: refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol
Deposited on 2001-06-20, released 2001-09-19
The last revision prior to the SCOP 1.71 freeze date was dated 2001-11-14, with a file datestamp of 2001-11-14.
Experiment type: EDIF
Resolution: 3.5 Å
R-factor: 0.231
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jffA (A:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jffA (A:)
    recisihvgqagvqignacwelyclehgiqpdghvpravfvdleptvidevrtgtyrqlf
    hpeqlitgkedaannyarghytigkeiidlvldrirkladqctglqgfsvfhsfgggtgs
    gftsllmerlsvdygkksklefsiypapqvstavvepynsiltthttlehsdcafmvdne
    aiydicrrnldierptytnlnrligqivssitaslrfdgalnvdltefqtnlvpyprghf
    platyapvisaekayheqlsvaeitnacfepanqmvkcdprhgkymaccllyrgdvvpkd
    vnaaiatiktkrtiqfvdwcptgfkvginyepptvvpggdlakvqravcmlsnttaiaea
    warldhkfdlmyakrafvhwyvgegmeegefsearedmaalekdyeevgvds
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jffB (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
    epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeegeedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jffB (B:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
    pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmma
    acdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprgl
    kmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvse
    yqqyqd