PDB entry 1jf6

View 1jf6 on RCSB PDB site
Description:
Deposited on 2001-06-20, released 2002-05-22
The last revision prior to the SCOP 1.61 freeze date was dated 2002-05-22, with a file datestamp of 2002-05-22.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.204
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jf6A (A:)
    mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
    gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
    vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
    yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
    vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetyavqvpampklrten
    pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
    gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
    dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
    rglfefykelirlrhrlasltrgnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqt
    vllqvpesggktwldcltgeevhgkqgqlkltlrpyqgmilwngr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jf6B (B:)
    mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
    gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
    vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
    yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
    vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetyavqvpampklrten
    pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
    gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
    dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
    rglfefykelirlrhrlasltrgnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqt
    vllqvpesggktwldcltgeevhgkqgqlkltlrpyqgmilwngr