PDB entry 1jf4

View 1jf4 on RCSB PDB site
Description: Crystal Structure Of Component IV Glycera Dibranchiata Monomeric Hemoglobin
Deposited on 2001-06-20, released 2002-06-20
The last revision prior to the SCOP 1.71 freeze date was dated 2002-06-20, with a file datestamp of 2002-06-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.189
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1jf4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jf4A (A:)
    glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
    kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
    kmnaaakdawaaayadisgalisglqs