PDB entry 1jf2

View 1jf2 on RCSB PDB site
Description: crystal structure of w92f obelin mutant from obelia longissima at 1.72 angstrom resolution
Deposited on 2001-06-19, released 2001-07-11
The last revision prior to the SCOP 1.59 freeze date was dated 2001-08-01, with a file datestamp of 2001-08-01.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.232
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jf2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jf2A (A:)
    avklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhq
    vcveaffrgcgmeygkeiafpqfldgfkqlatselkkwarneptlirewgdavfdifdkd
    gsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpe
    adglygngvp