PDB entry 1jez

View 1jez on RCSB PDB site
Description: the structure of xylose reductase, a dimeric aldo-keto reductase from candida tenuis
Class: oxidoreductase
Keywords: tim barrel, aldo-keto reductase, nadph, nadh, oxidoreductase
Deposited on 2001-06-19, released 2002-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jeza_
  • Chain 'B':
    Compound: xylose reductase
    Species: Candida tenuis [TaxId:45596]
    Gene: XYLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jezb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jezA (A:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jezA (A:)
    sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk
    raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp
    ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga
    tikpavlqvehhpylqqpkliefaqkagvtitaystlfahdtikaiaakynktpaevllr
    waaqrgiavipksnlperlvqnrsfntfdltkedfeeiakldiglrfndpwdwdnipifv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jezB (B:)
    msasipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgd
    gvkraideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafk
    fvpieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldll
    rgatikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlf
    ahdtikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeei
    akldiglrfndpwdwdnipifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jezB (B:)
    pdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvkra
    ideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvpie
    ekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrgati
    kpavlqvehhpylqqpkliefaqkagvtitayssflfahdtikaiaakynktpaevllrw
    aaqrgiavipksnlperlvqnrsfntfdltkedfeeiakldiglrfndpwdwdnipifv