PDB entry 1jey

View 1jey on RCSB PDB site
Description: Crystal Structure of the Ku heterodimer bound to DNA
Class: DNA binding protein/DNA
Keywords: double-strand DNA break repair, non-homologous end-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel, helical C-terminal arm, SAP domain, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2001-06-19, released 2001-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ku70
    Species: Homo sapiens [TaxId:9606]
    Gene: G22P1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jeya1, d1jeya2
  • Chain 'B':
    Compound: Ku80
    Species: Homo sapiens [TaxId:9606]
    Gene: XRCC5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jeyb1, d1jeyb2
  • Chain 'C':
    Compound: DNA (5'-d(*gp*tp*tp*tp*tp*tp*ap*gp*tp*tp*tp*ap*tp*tp*gp*gp*gp*cp*gp*cp*g)-3')
  • Chain 'D':
    Compound: DNA (34-mer)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jeyA (A:)
    msgwesyyktegdeeaeeeqeenleasgdykysgrdsliflvdaskamfesqsedeltpf
    dmsiqciqsvyiskiissdrdllavvfygtekdknsvnfkniyvlqeldnpgakrileld
    qfkgqqgqkrfqdmmghgsdyslsevlwvcanlfsdvqfkmshkrimlftnednphgnds
    akasrartkagdlrdtgifldlmhlkkpggfdislfyrdiisiaededlrvhfeesskle
    dllrkvraketrkralsrlklklnkdivisvgiynlvqkalkpppiklyretnepvktkt
    rtfntstgglllpsdtkrsqiygsrqiilekeeteelkrfddpglmlmgfkplvllkkhh
    ylrpslfvypeeslvigsstlfsallikclekevaalcrytprrnippyfvalvpqeeel
    ddqkiqvtppgfqlvflpfaddkrkmpftekimatpeqvgkmkaiveklrftyrsdsfen
    pvlqqhfrnlealaldlmepeqavdltlpkveamnkrlgslvdefkelvyppdynpegkv
    tkrkhdnegsgskrpkveyseeelkthiskgtlgkftvpmlkeacrayglksglkkqell
    ealtkhfqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jeyA (A:)
    grdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekd
    knsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanl
    fsdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdi
    slfyrdiisvhfeesskledllrkvraketrkralsrlklklnkdivisvgiynlvqkal
    kpppiklyretnepvktktrtfntstgglllpsdtkrsqiygsrqiilekeeteelkrfd
    dpglmlmgfkplvllkkhhylrpslfvypeeslvigsstlfsallikclekevaalcryt
    prrnippyfvalvpqeeelddqkiqvtppgfqlvflpfaddkrkmpftekimatpeqvgk
    mkaiveklrftyrsdsfenpvlqqhfrnlealaldlmepeqavdltlpkveamnkrlgsl
    vdefkelvyppdy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jeyB (B:)
    mvrsgnkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfg
    tdgtdnplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqh
    etigkkfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslgkedgsgdrgd
    gpfrlgghgpsfplkgiteqqkegleivkmvmislegedgldeiysfseslrklcvfkki
    erhsihwpcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvyclndd
    detevlkediiqgfrygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnq
    vlkvfaarddeaaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclv
    yvqlpfmedlrqymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfptt
    kipnprfqrlfqcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfpli
    eakkkdqvtaqeifqdnhedgptak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jeyB (B:)
    nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
    nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
    kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslggpfrlgghgpsfplk
    giteqqkegleivkmvmislegedgldeiysfseslrklcvfkkierhsihwpcrltigs
    nlsiriaayksilqervkktwtvvdaktlkkediqketvyclndddetevlkediiqgfr
    ygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkvfaarddeaaav
    alsslihalddldmvaivryaydkranpqvgvafphikhnyeclvyvqlpfmedlrqymf
    sslknskkyapteaqlnavdalidsmslakkdektdtledlfpttkipnprfqrlfqcll
    hralhpreplppiqqhiwnmlnppaevttksqiplskiktlfplieakkk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.