PDB entry 1jeq

View 1jeq on RCSB PDB site
Description: Crystal Structure of the Ku Heterodimer
Class: DNA binding protein
Keywords: double-strand DNA break repair, non-homologous end-joining, alpha/beta domain, beta barrel, helical C-terminal arm, sap domain, DNA BINDING PROTEIN
Deposited on 2001-06-18, released 2001-08-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ku70
    Species: Homo sapiens [TaxId:9606]
    Gene: G22P1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1jeqa1, d1jeqa3, d1jeqa4
  • Chain 'B':
    Compound: Ku80
    Species: Homo sapiens [TaxId:9606]
    Gene: XRCC5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1jeqb1, d1jeqb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jeqA (A:)
    msgwesyyktegdeeaeeeqeenleasgdykysgrdsliflvdaskamfesqsedeltpf
    dmsiqciqsvyiskiissdrdllavvfygtekdknsvnfkniyvlqeldnpgakrileld
    qfkgqqgqkrfqdmmghgsdyslsevlwvcanlfsdvqfkmshkrimlftnednphgnds
    akasrartkagdlrdtgifldlmhlkkpggfdislfyrdiisiaededlrvhfeesskle
    dllrkvraketrkralsrlklklnkdivisvgiynlvqkalkpppiklyretnepvktkt
    rtfntstgglllpsdtkrsqiygsrqiilekeeteelkrfddpglmlmgfkplvllkkhh
    ylrpslfvypeeslvigsstlfsallikclekevaalcrytprrnippyfvalvpqeeel
    ddqkiqvtppgfqlvflpfaddkrkmpftekimatpeqvgkmkaiveklrftyrsdsfen
    pvlqqhfrnlealaldlmepeqavdltlpkveamnkrlgslvdefkelvyppdynpegkv
    tkrkhdnegsgskrpkveyseeelkthiskgtlgkftvpmlkeacrayglksglkkqell
    ealtkhfqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jeqA (A:)
    rdsliflvdaskamfesqsedeltpfdmsiqciqsvyiskiissdrdllavvfygtekdk
    nsvnfkniyvlqeldnpgakrileldqfkgqqgqkrfqdmmghgsdyslsevlwvcanlf
    sdvqfkmshkrimlftnednphgndsakasrartkagdlrdtgifldlmhlkkpggfdis
    lfyrdiisivhfeesskledllrkvraketrkralsrlklklnkdivisvgiynlvqkal
    kpppiklyretnepvktktrtfntstgglllpsdtkrsqiygsrqiilekeeteelkrfd
    dpglmlmgfkplvllkkhhylrpslfvypeeslvigsstlfsallikclekevaalcryt
    prrnippyfvalvpqeeelddqkiqvtppgfqlvflpfaddkrkmpftekimatpeqvgk
    mkaiveklrftyrsdsfenpvlqqhfrnlealaldlmepeqavdltlpkveamnkrlgsl
    vdefkelvyppdynpegyseeelkthiskgtlgkftvpmlkeacrayglksglkkqelle
    altkhfqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jeqB (B:)
    mvrsgnkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfg
    tdgtdnplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqh
    etigkkfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslgkedgsgdrgd
    gpfrlgghgpsfplkgiteqqkegleivkmvmislegedgldeiysfseslrklcvfkki
    erhsihwpcrltigsnlsiriaayksilqervkktwtvvdaktlkkediqketvyclndd
    detevlkediiqgfrygsdivpfskvdeeqmkyksegkcfsvlgfckssqvqrrffmgnq
    vlkvfaarddeaaavalsslihalddldmvaivryaydkranpqvgvafphikhnyeclv
    yvqlpfmedlrqymfsslknskkyapteaqlnavdalidsmslakkdektdtledlfptt
    kipnprfqrlfqcllhralhpreplppiqqhiwnmlnppaevttksqiplskiktlfpli
    eakkkdqvtaqeifqdnhedgptak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jeqB (B:)
    nkaavvlcmdvgftmsnsipgiespfeqakkvitmfvqrqvfaenkdeialvlfgtdgtd
    nplsggdqyqnitvhrhlmlpdfdlledieskiqpgsqqadfldalivsmdviqhetigk
    kfekrhieiftdlssrfsksqldiiihslkkcdislqfflpfslpfrlgghgfplkgite
    qqkegleivkmvmislegedgldeiysfseslrklcvfkkierhsihwpcrltigsnlsi
    riaayksilqervkktwtvvdaktlkkediqketvyclndddetevlkediiqgfrygsd
    ivpfdeeqmkyksegkcfsvlgfckssqvqrrffmgnqvlkvfaarddeaaavalsslih
    alddldmvaivryaydkranpqvgvafphikhnyeclvyvqlpfmedlrqymfsslknsk
    kyapteaqlnavdalidsmslakkdektdtledlfpttkipnprfqrlfqcllhralhpr
    eplppiqqhiwnmlnppaevttksqiplskiktlfpliea