PDB entry 1jem

View 1jem on RCSB PDB site
Description: nmr structure of histidine phosphorylated form of the phosphocarrier histidine containing protein from bacillus subtilis, nmr, 25 structures
Class: phosphotransferase
Keywords: histidine containing protein, phosphohistidine, pts, phosphotransferase
Deposited on 1997-04-01, released 1997-07-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine containing protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08877 (0-86)
      • modified residue (13)
      • engineered (49)
    Domains in SCOPe 2.01: d1jema_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jemA (A:)
    aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvvslgiakgaei
    tisasgadendalnaleetmkseglge