PDB entry 1jek

View 1jek on RCSB PDB site
Description: visna tm core structure
Deposited on 2001-06-18, released 2001-07-25
The last revision prior to the SCOP 1.63 freeze date was dated 2001-07-25, with a file datestamp of 2001-07-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.213
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1jek.1
  • Chain 'B':
    Domains in SCOP 1.63: d1jek.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jekA (A:)
qslanataaqqevleasyamvqhiakgirilearvarvea

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jekB (B:)
wqqweeeieqhegnlslllreaalqvhiaqrdar