PDB entry 1jek

View 1jek on RCSB PDB site
Description: visna tm core structure
Deposited on 2001-06-18, released 2001-07-25
The last revision was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.213
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: env polyprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: env polyprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.57, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1jekA (A:)
qslanataaqqevleasyamvqhiakgirilearvarvea

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1jekB (B:)
wqqweeeieqhegnlslllreaalqvhiaqrdar