PDB entry 1jei

View 1jei on RCSB PDB site
Description: lem domain of human inner nuclear membrane protein emerin
Class: membrane protein
Keywords: emerin nucleus membrane domain dystrophy, MEMBRANE PROTEIN
Deposited on 2001-06-18, released 2001-07-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: emerin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1jeia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jeiA (A:)
    dnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrrlsppsss