PDB entry 1jeh

View 1jeh on RCSB PDB site
Description: crystal structure of yeast e3, lipoamide dehydrogenase
Class: oxidoreductase
Keywords: 2-oxoglutarate dehydrogenase complex, pyruvate dehydrogenase complex, OXIDOREDUCTASE
Deposited on 2001-06-18, released 2001-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoamide dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jeha1, d1jeha2, d1jeha3
  • Chain 'B':
    Compound: dihydrolipoamide dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jehb1, d1jehb2, d1jehb3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jehA (A:)
    tinkshdvviigggpagyvaaikaaqlgfntacvekrgklggtclnvgcipskallnnsh
    lfhqmhteaqkrgidvngdikinvanfqkakddavkqltggiellfkknkvtyykgngsf
    edetkirvtpvdglegtvkedhildvkniivatgsevtpfpgieideekivsstgalslk
    eipkrltiigggiiglemgsvysrlgskvtvvefqpqigasmdgevakatqkflkkqgld
    fklstkvisakrnddknvveivvedtktnkqenleaevllvavgrrpyiaglgaekigle
    vdkrgrlviddqfnskfphikvvgdvtfgpmlahkaeeegiaavemlktghghvnynnip
    svmyshpevawvgkteeqlkeagidykigkfpfaansraktnqdtegfvkilidskteri
    lgahiigpnagemiaeaglaleygasaedvarvchahptlseafkeanmaaydkaihc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jehB (B:)
    tinkshdvviigggpagyvaaikaaqlgfntacvekrgklggtclnvgcipskallnnsh
    lfhqmhteaqkrgidvngdikinvanfqkakddavkqltggiellfkknkvtyykgngsf
    edetkirvtpvdglegtvkedhildvkniivatgsevtpfpgieideekivsstgalslk
    eipkrltiigggiiglemgsvysrlgskvtvvefqpqigasmdgevakatqkflkkqgld
    fklstkvisakrnddknvveivvedtktnkqenleaevllvavgrrpyiaglgaekigle
    vdkrgrlviddqfnskfphikvvgdvtfgpmlahkaeeegiaavemlktghghvnynnip
    svmyshpevawvgkteeqlkeagidykigkfpfaansraktnqdtegfvkilidskteri
    lgahiigpnagemiaeaglaleygasaedvarvchahptlseafkeanmaaydkaihc