PDB entry 1jee

View 1jee on RCSB PDB site
Description: Crystal Structure of ATP Sulfurylase in complex with chlorate
Class: transferase
Keywords: alpha-beta protein, beta-barrel, Rossmann-fold, inhibitor complex, chlorate, TRANSFERASE
Deposited on 2001-06-17, released 2001-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sulfate adenylyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jeea1, d1jeea2, d1jeea3
  • Chain 'B':
    Compound: sulfate adenylyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jeeb1, d1jeeb2, d1jeeb3
  • Heterogens: CD, CA, NA, MG, LCO, ADX, POP, TRS, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jeeA (A:)
    paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
    endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
    kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlrl
    efqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvrv
    yqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknskg
    vdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgtel
    rrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstflq
    fgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldtsssa
    diqlesadepishivqkvvlfledngffvf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jeeB (B:)
    paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
    endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
    kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlrl
    efqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvrv
    yqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknskg
    vdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgtel
    rrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstflq
    fgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldtsssa
    diqlesadepishivqkvvlfledngffvf