PDB entry 1jeb

View 1jeb on RCSB PDB site
Description: Chimeric Human/Mouse Carbonmonoxy Hemoglobin (Human Zeta2 / Mouse Beta2)
Deposited on 2001-06-17, released 2002-01-23
The last revision prior to the SCOP 1.63 freeze date was dated 2002-01-23, with a file datestamp of 2002-01-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1jeba_
  • Chain 'B':
    Domains in SCOP 1.63: d1jebb_
  • Chain 'C':
    Domains in SCOP 1.63: d1jebc_
  • Chain 'D':
    Domains in SCOP 1.63: d1jebd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jebA (A:)
    sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs
    kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae
    ahaawdkflsvvssvltekyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jebB (B:)
    vhltdaekaavsglwgkvnadevggealgrllvvypwtqryfdsfgdlssasaimgnakv
    kahgkkvitafndglnhldslkgtfaslselhcdklhvdpenfrllgnmivivlghhlgk
    dftpaaqaafqkvvagvaaalah
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jebC (C:)
    sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs
    kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae
    ahaawdkflsvvssvltekyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jebD (D:)
    vhltdaekaavsglwgkvnadevggealgrllvvypwtqryfdsfgdlssasaimgnakv
    kahgkkvitafndglnhldslkgtfaslselhcdklhvdpenfrllgnmivivlghhlgk
    dftpaaqaafqkvvagvaaalahkyh