PDB entry 1je6

View 1je6 on RCSB PDB site
Description: Structure of the MHC Class I Homolog MICB
Class: immune system
Keywords: delta-tcr, glycoprotein, signa immunoglobulin fold, T-cell, immune system
Deposited on 2001-06-15, released 2002-08-07
The last revision prior to the SCOP 1.73 freeze date was dated 2002-08-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.255
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I chain-related protein
    Species: HOMO SAPIENS
    Gene: MICB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P79525 (1-274)
      • initiating met (0)
    Domains in SCOP 1.73: d1je6a1, d1je6a2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1je6A (A:)
    mephslrynlmvlsqdgsvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw
    dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls
    qnletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksgvair
    rtvppmvnvtcsevsegnitvtcrassfyprnitltwrqdgvslshntqqwgdvlpdgng
    tyqtwvatrirqgeeqrftcymehsgnhgthpvps