PDB entry 1je4

View 1je4 on RCSB PDB site
Description: solution structure of the monomeric variant of the chemokine mip-1beta
Deposited on 2001-06-15, released 2001-10-03
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-03, with a file datestamp of 2001-10-03.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1je4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1je4A (A:)
  apmgsdpptaccasytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
  eyvydleln