PDB entry 1je3

View 1je3 on RCSB PDB site
Description: solution structure of ec005 from escherichia coli
Deposited on 2001-06-15, released 2002-03-06
The last revision prior to the SCOP 1.65 freeze date was dated 2002-03-06, with a file datestamp of 2002-03-06.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.65: d1je3a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1je3A (A:)
  mgsshhhhhhssglvprgshmknivpdyrldmvgepcpypavatleampqlkkgeilevv
  sdcpqsinnipldarnhgytvldiqqdgptiryliqk