PDB entry 1je3

View 1je3 on RCSB PDB site
Description: Solution Structure of EC005 from Escherichia coli
Class: structural genomics
Keywords: mixed alpha-beta structure, structural genomics
Deposited on 2001-06-15, released 2002-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical 8.6 kda protein in amya-flie intergenic region
    Species: Escherichia coli [TaxId:562]
    Gene: YEDF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA31 (20-96)
      • expression tag (0-19)
    Domains in SCOPe 2.08: d1je3a1, d1je3a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1je3A (A:)
mgsshhhhhhssglvprgshmknivpdyrldmvgepcpypavatleampqlkkgeilevv
sdcpqsinnipldarnhgytvldiqqdgptiryliqk