PDB entry 1jdy

View 1jdy on RCSB PDB site
Description: rabbit muscle phosphoglucomutase
Class: phosphotransferase
Keywords: phosphoglucomutase, phosphotransferase
Deposited on 1996-07-11, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.186
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglucomutase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jdya1, d1jdya2, d1jdya3, d1jdya4
  • Chain 'B':
    Compound: phosphoglucomutase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jdyb1, d1jdyb2, d1jdyb3, d1jdyb4
  • Heterogens: CD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jdyA (A:)
    vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
    gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
    kpftveivdsveayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceel
    gapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhg
    ffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkf
    fgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
    rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
    gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
    ialkvsqlqertgrtaptvit
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jdyB (B:)
    vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
    gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
    kpftveivdsveayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceel
    gapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhg
    ffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkf
    fgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
    rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
    gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
    ialkvsqlqertgrtaptvit