PDB entry 1jdx

View 1jdx on RCSB PDB site
Description: crystal structure of human l-arginine:glycine amidinotransferase in complex with l-norvaline
Class: transferase
Keywords: creatine biosynthesis, catalytic triad, reaction mechanism, novel fold, fivefold pseudosymmetry, transferase
Deposited on 1998-10-12, released 1999-02-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (l-arginine:glycine amidinotransferase)
    Species: Homo sapiens [TaxId:9606]
    Gene: AT38H
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1jdxa_
  • Heterogens: NVA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jdxA (A:)
    stqaatassrnscaaddkateplpkdcpvssynewdpleevivgraenacvppftievka
    ntyekywpfyqkqgghyfpkdhlkkavaeieemcnilktegvtvrrpdpidwslkyktpd
    festglysamprdilivvgneiieapmawrsrffeyrayrsiikdyfhrgakwttapkpt
    madelynqdypihsvedrhklaaqgkfvttefepcfdaadfiragrdifaqrsqvtnylg
    iewmrrhlapdyrvhiisfkdpnpmhidatfniigpgivlsnpdrpchqidlfkkagwti
    itpptpiipddhplwmsskwlsmnvlmldekrvmvdanevpiqkmfeklgittikvnirn
    anslgggfhcwtcdvrrrgtlqsyld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jdxA (A:)
    cpvssynewdpleevivgraenacvppftievkantyekywpfyqkqgghyfpkdhlkka
    vaeieemcnilktegvtvrrpdpidwslkyktpdfestglysamprdilivvgneiieap
    mawrsrffeyrayrsiikdyfhrgakwttapkptmadelynqdypihsvedrhklaaqgk
    fvttefepcfdaadfiragrdifaqrsqvtnylgiewmrrhlapdyrvhiisfkdpnpmh
    idatfniigpgivlsnpdrpchqidlfkkagwtiitpptpiipddhplwmsskwlsmnvl
    mldekrvmvdanevpiqkmfeklgittikvnirnanslgggfhcwtcdvrrrgtlqsyld