PDB entry 1jdw

View 1jdw on RCSB PDB site
Description: crystal structure and mechanism of l-arginine: glycine amidinotransferase: a mitochondrial enzyme involved in creatine biosynthesis
Class: transferase
Keywords: transferase, creatine biosynthesis, catalytic triad, reaction mechanism, novel fold, fivefold pseudosymmetry
Deposited on 1997-01-22, released 1998-01-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-arginine:glycine amidinotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: AT38H
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1jdwa_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jdwA (A:)
    mlrvrclrggsrgaeavhyigsrlgrtltgwvqrtfqstqaatassrnscaaddkatepl
    pkdcpvssynewdpleevivgraenacvppftievkantyekywpfyqkqgghyfpkdhl
    kkavaeieemcnilktegvtvrrpdpidwslkyktpdfestglysamprdilivvgneii
    eapmawrsrffeyrayrsiikdyfhrgakwttapkptmadelynqdypihsvedrhklaa
    qgkfvttefepcfdaadfiragrdifaqrsqvtnylgiewmrrhlapdyrvhiisfkdpn
    pmhidatfniigpgivlsnpdrpchqidlfkkagwtiitpptpiipddhplwmsskwlsm
    nvlmldekrvmvdanevpiqkmfeklgittikvnirnanslgggfhcwtcdvrrrgtlqs
    yld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jdwA (A:)
    cpvssynewdpleevivgraenacvppftievkantyekywpfyqkqgghyfpkdhlkka
    vaeieemcnilktegvtvrrpdpidwslkyktpdfestglysamprdilivvgneiieap
    mawrsrffeyrayrsiikdyfhrgakwttapkptmadelynqdypihsvedrhklaaqgk
    fvttefepcfdaadfiragrdifaqrsqvtnylgiewmrrhlapdyrvhiisfkdpnpmh
    idatfniigpgivlsnpdrpchqidlfkkagwtiitpptpiipddhplwmsskwlsmnvl
    mldekrvmvdanevpiqkmfeklgittikvnirnanslgggfhcwtcdvrrrgtlqsyld