PDB entry 1jdr

View 1jdr on RCSB PDB site
Description: Crystal Structure of a Proximal Domain Potassium Binding Variant of Cytochrome c Peroxidase
Deposited on 2001-06-14, released 2001-06-27
The last revision prior to the SCOP 1.69 freeze date was dated 2001-06-27, with a file datestamp of 2001-06-27.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.197
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1jdra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jdrA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahtlgkt
    hlknsgyegpwtannnvfdnsfylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl