PDB entry 1jdr

View 1jdr on RCSB PDB site
Description: Crystal Structure of a Proximal Domain Potassium Binding Variant of Cytochrome c Peroxidase
Class: oxidoreductase
Keywords: helical bundle protein, OXIDOREDUCTASE
Deposited on 2001-06-14, released 2001-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.197
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: OPBYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-293)
      • engineered (175)
      • engineered (191)
      • engineered (193)
      • engineered (198)
      • engineered (200)
    Domains in SCOPe 2.07: d1jdra_
  • Heterogens: K, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jdrA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahtlgkt
    hlknsgyegpwtannnvfdnsfylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl