PDB entry 1jdq

View 1jdq on RCSB PDB site
Description: Solution Structure of TM006 Protein from Thermotoga maritima
Class: structural genomics
Keywords: TM006, Thermotoga maritima, STRUCTURAL GENOMICS
Deposited on 2001-06-14, released 2002-02-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein tm0983
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X078 (19-97)
      • expression tag (0-18)
    Domains in SCOPe 2.02: d1jdqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jdqA (A:)
gsshhhhhhssglvprgshmakyqvtktldvrgevcpvpdvetkralqnmkpgeilevwi
dypmskeripetvkklghevleieevgpsewkiyikvk