PDB entry 1jdq

View 1jdq on RCSB PDB site
Description: Solution Structure of TM006 Protein from Thermotoga maritima
Class: structural genomics
Keywords: TM006, Thermotoga maritima, STRUCTURAL GENOMICS
Deposited on 2001-06-14, released 2002-02-27
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein tm0983
  Species: Thermotoga maritima
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9X078 (19-97)
    • his tag (0-18)
  Domains in SCOP 1.75: d1jdqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jdqA (A:)
  gsshhhhhhssglvprgshmakyqvtktldvrgevcpvpdvetkralqnmkpgeilevwi
  dypmskeripetvkklghevleieevgpsewkiyikvk