PDB entry 1jdq

View 1jdq on RCSB PDB site
Description: solution structure of tm006 protein from thermotoga maritima
Deposited on 2001-06-14, released 2002-02-27
The last revision prior to the SCOP 1.71 freeze date was dated 2002-02-27, with a file datestamp of 2002-02-27.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1jdqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jdqA (A:)
  gsshhhhhhssglvprgshmakyqvtktldvrgevcpvpdvetkralqnmkpgeilevwi
  dypmskeripetvkklghevleieevgpsewkiyikvk