PDB entry 1jdp

View 1jdp on RCSB PDB site
Description: Crystal Structure of Hormone/Receptor Complex
Class: signaling protein
Keywords: hormone-receptor complex, natriuretic peptide receptor, allosteric activation, SIGNALING PROTEIN
Deposited on 2001-06-14, released 2001-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.227
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: atrial natriuretic peptide clearance receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jdpa_
  • Chain 'B':
    Compound: atrial natriuretic peptide clearance receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jdpb_
  • Chain 'H':
    Compound: c-type natriuretic peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NDG, NAG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jdpA (A:)
    erealppqkievlvllpqddsylfsltrvrpaieyalrsvegngtgrrllppgtrfqvay
    edsdcgnralfslvdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaag
    fqhkdseyshltrvapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhev
    fqeeglhtsiysfdetkdldledivrniqaservvimcassdtirsimlvahrhgmtsgd
    yaffnielfnsssygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssv
    ekqglnmedyvnmfvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagq
    vsidangdrygdfsviamtdveagtqevigdyfgkegrfemrpnvkypwgplklridenr
    ivehtnsspckscgleesavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jdpA (A:)
    ealppqkievlvllpqddsylfsltrvrpaieyalrsvegrllppgtrfqvayedsdcgn
    ralfslvdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaagfqhkdse
    yshltrvapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhevfqeeglh
    tsiysfdetkdldledivrniqaservvimcassdtirsimlvahrhgmtsgdyaffnie
    lfnsssygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssvekqglnm
    edyvnmfvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagqvsidang
    drygdfsviamtdveagtqevigdyfgkegrfemrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jdpB (B:)
    erealppqkievlvllpqddsylfsltrvrpaieyalrsvegngtgrrllppgtrfqvay
    edsdcgnralfslvdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaag
    fqhkdseyshltrvapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhev
    fqeeglhtsiysfdetkdldledivrniqaservvimcassdtirsimlvahrhgmtsgd
    yaffnielfnsssygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssv
    ekqglnmedyvnmfvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagq
    vsidangdrygdfsviamtdveagtqevigdyfgkegrfemrpnvkypwgplklridenr
    ivehtnsspckscgleesavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jdpB (B:)
    alppqkievlvllpqddsylfsltrvrpaieyalrsvegrllppgtrfqvayedsdcgnr
    alfslvdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaagfqhkdsey
    shltrvapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhevfqeeglht
    siysfdetkdldledivrniqaservvimcassdtirsimlvahrhgmtsgdyaffniel
    fnsssygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssvekqglnme
    dyvnmfvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagqvsidangd
    rygdfsviamtdveagtqevigdyfgkegrfemrp
    

  • Chain 'H':
    No sequence available.