PDB entry 1jdo

View 1jdo on RCSB PDB site
Description: sperm whale myoglobin (ferrous, nitric oxide bound)
Deposited on 1998-02-10, released 1998-05-27
The last revision prior to the SCOP 1.71 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.155
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1jdo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jdo_ (-)
    mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg