PDB entry 1jdn

View 1jdn on RCSB PDB site
Description: Crystal Structure of Hormone Receptor
Class: signaling protein
Keywords: Natriuretic peptide receptor, dimer, allosteric activation, SIGNALING PROTEIN
Deposited on 2001-06-14, released 2001-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.243
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: atrial natriuretic peptide clearance receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jdna_
  • Heterogens: CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jdnA (A:)
    erealppqkievlvllpqddsylfsltrvrpaieyalrsvegngtgrrllppgtrfqvay
    edsdcgnralfslvdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaag
    fqhkdseyshltrvapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhev
    fqeeglhtsiysfdetkdldledivrniqaservvimcassdtirsimlvahrhgmtsgd
    yaffnielfnsssygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssv
    ekqglnmedyvnmfvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagq
    vsidangdrygdfsviamtdveagtqevigdyfgkegrfemrpnvkypwgplklridenr
    ivehtnsspckscgleesavt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jdnA (A:)
    pqkievlvllpqddsylfsltrvrpaieyalrsveglppgtrfqvayedsdcgnralfsl
    vdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaagfqhkdseyshltr
    vapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhevfqeeglhtsiysf
    detkdldledivrniqaservvimcassdtirsimlvahrhgmtsgdyaffnielfnsss
    ygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssvekqglnmedyvnm
    fvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagqvsidangdrygdf
    sviamtdveagtqevigdyfgkegrfemrpnvkypwgplklridenr