PDB entry 1jdl

View 1jdl on RCSB PDB site
Description: Structure of cytochrome c2 from Rhodospirillum Centenum
Class: electron transport
Keywords: alpha helix, electron transport
Deposited on 2001-06-14, released 2001-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c2, iso-2
    Species: Rhodospirillum centenum [TaxId:34018]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jdla_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jdlA (A:)
    edgdpakgeavfkkcmachrvgpdaknlvgpaltgvidrqagtapgfnysainhaageag
    lhwtpeniiaylpdpnaflrkfladaghaeqakgstkmvfklpdeqerkdvvaylkqfsp
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jdlA (A:)
    gdpakgeavfkkcmachrvgpdaknlvgpaltgvidrqagtapgfnysainhaageaglh
    wtpeniiaylpdpnaflrkfladaghaeqakgstkmvfklpdeqerkdvvaylkqfsp