PDB entry 1jdh

View 1jdh on RCSB PDB site
Description: crystal structure of beta-catenin and htcf-4
Class: transcription
Keywords: beta-catenin, tcf4, protein-protein complex
Deposited on 2001-06-13, released 2001-12-05
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-catenin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jdha_
  • Chain 'B':
    Compound: hTcf-4
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jdhb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jdhA (A:)
    avvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqm
    vsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfy
    aittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskli
    ilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdps
    qrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnykn
    kmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvv
    vkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmg
    gtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrva
    agvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrms
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jdhA (A:)
    avvnliraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqn
    tndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlll
    hqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqal
    vnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwt
    lrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggi
    ealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshw
    plikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqfvegvrmeeivegctg
    alhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaeg
    atapltellhsrnegvatyaaavlfrms
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jdhB (B:)
    lgandelisfkdegeqeekssenssaerdladvksslv