PDB entry 1jde

View 1jde on RCSB PDB site
Description: K22A mutant of pyruvate, phosphate dikinase
Class: transferase
Keywords: TRANSFERASE, PHOSPHOTRANSFERASE, KINASE, nucleotide binding site mutant
Deposited on 2001-06-13, released 2001-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.193
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate, phosphate dikinase
    Species: Clostridium symbiosum [TaxId:1512]
    Gene: PODK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22983 (0-872)
      • engineered (20)
    Domains in SCOPe 2.06: d1jdea1, d1jdea2, d1jdea3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jdeA (A:)
    akwvykfeegnasmrnllggagcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkiykgdietqeasvsgsferimvwadkfrtlkvrtnad
    tpedtlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgd
    fkamykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpm
    mghrgcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvv
    vevaeqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrdd
    agkfldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssv
    efchkvglnyvscspfrvpiarlaaaqaalnnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jdeA (A:)
    akwvykfeegnasmrnllggagcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkietqeasvsgsferimvwadkfrtlkvrtnadtpedt
    lnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgdfkamy
    kalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpmmghrg
    crlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvvvevae
    qvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrddagkfl
    dsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssvefchk
    vglnyvscspfrvpiarlaaaqaalnnk