PDB entry 1jco

View 1jco on RCSB PDB site
Description: Solution structure of the monomeric [Thr(B27)->Pro,Pro(B28)->Thr] insulin mutant (PT insulin)
Class: hormone/growth factor
Keywords: Helix-turn-helix, Coil-helix-coil
Deposited on 2001-06-11, released 2001-10-03
The last revision prior to the SCOP 1.73 freeze date was dated 2001-10-03, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin A chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1jco.1
  • Chain 'B':
    Compound: insulin B chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-29)
      • engineered (26-27)
    Domains in SCOP 1.73: d1jco.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jcoA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jcoB (B:)
    fvnqhlcgshlvealylvcgergffyptkt