PDB entry 1jcn

View 1jcn on RCSB PDB site
Description: binary complex of human type-i inosine monophosphate dehydrogenase with 6-cl-imp
Deposited on 2001-06-11, released 2003-06-17
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-17, with a file datestamp of 2003-06-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: -1.73 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jcnA (A:)
    madylisggtgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkit
    lktplisspmdtvteadmaiamalmggigfihhnctpefqanevrkvknfeqgfitdpvv
    lspshtvgdvleakmrhgfsgipitetgtmgsklvgivtsrdidflaekdhttllsevmt
    prielvvapagvtlkeaneilqrskkgklpivndcdelvaiiartdlkknrdyplaskds
    qkqllcgaavgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqkyphlqvi
    ggnvvtaaqaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeyarrfgvp
    iiadggiqtvghvvkalalgastvmmgsllaatteapgeyffsdgvrlkkyrgmgsldam
    ekssssqkryfsegdkvkiaqgvsgsiqdkgsiqkfvpyliagiqhgcqdigarslsvlr
    smmysgelkfekrtmsaqieggvhglhsyekrly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jcnA (A:)
    tgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkitlktplissp
    mdtvteadmaiamalmggigfihhnctpefqanevrkvknfeqgfitdpvvlspgipite
    vgivtsrdidprielvvapagvtlkeaneilqrskkgklpivndcdelvrtdlkknrdyp
    laskdsqkqllcgaavgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqky
    phlqviggnvvtaaqaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeya
    rrfgvpiiadggiqtvghvvkalalgastvmmgsllaatteapgekgsiqkfvpyliagi
    qhgcqdigarslsvlrsmmysgelkfekrtmsaqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jcnB (B:)
    madylisggtgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkit
    lktplisspmdtvteadmaiamalmggigfihhnctpefqanevrkvknfeqgfitdpvv
    lspshtvgdvleakmrhgfsgipitetgtmgsklvgivtsrdidflaekdhttllsevmt
    prielvvapagvtlkeaneilqrskkgklpivndcdelvaiiartdlkknrdyplaskds
    qkqllcgaavgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqkyphlqvi
    ggnvvtaaqaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeyarrfgvp
    iiadggiqtvghvvkalalgastvmmgsllaatteapgeyffsdgvrlkkyrgmgsldam
    ekssssqkryfsegdkvkiaqgvsgsiqdkgsiqkfvpyliagiqhgcqdigarslsvlr
    smmysgelkfekrtmsaqieggvhglhsyekrly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jcnB (B:)
    tgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkitlktplissp
    mdtvteadmaiamalmggigfihhnctpefqanevrkvknfeqgfitdpvvlspgipite
    vgivtsrdidprielvvapagvtlkeaneilqrskkgklpivndcdelvrtdlkknrdyp
    laskdsqkqllcgaavgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqky
    phlqviggnvvtaaqaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeya
    rrfgvpiiadggiqtvghvvkalalgastvmmgsllaatteapgekgsiqkfvpyliagi
    qhgcqdigarslsvlrsmmysgelkfekrtmsaqi