PDB entry 1jcn

View 1jcn on RCSB PDB site
Description: binary complex of human type-I inosine monophosphate dehydrogenase with 6-cl-imp
Class: oxidoreductase
Keywords: dehydrogenase, impd, impdh, guanine nucleotide synthesis, oxidoreductase
Deposited on 2001-06-11, released 2003-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: -1.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inosine monophosphate dehydrogenase I
    Species: Homo sapiens [TaxId:9606]
    Gene: impdh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jcna1, d1jcna4
  • Chain 'B':
    Compound: inosine monophosphate dehydrogenase I
    Species: Homo sapiens [TaxId:9606]
    Gene: impdh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1jcnb1, d1jcnb4
  • Heterogens: CPR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jcnA (A:)
    madylisggtgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkit
    lktplisspmdtvteadmaiamalmggigfihhnctpefqanevrkvknfeqgfitdpvv
    lspshtvgdvleakmrhgfsgipitetgtmgsklvgivtsrdidflaekdhttllsevmt
    prielvvapagvtlkeaneilqrskkgklpivndcdelvaiiartdlkknrdyplaskds
    qkqllcgaavgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqkyphlqvi
    ggnvvtaaqaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeyarrfgvp
    iiadggiqtvghvvkalalgastvmmgsllaatteapgeyffsdgvrlkkyrgmgsldam
    ekssssqkryfsegdkvkiaqgvsgsiqdkgsiqkfvpyliagiqhgcqdigarslsvlr
    smmysgelkfekrtmsaqieggvhglhsyekrly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jcnA (A:)
    tgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkitlktplissp
    mdtvteadmaiamalmggigfihhnctpefqanevrkvknfeqgfitdpvvlspgipite
    vgivtsrdidprielvvapagvtlkeaneilqrskkgklpivndcdelvrtdlkknrdyp
    laskdsqkqllcgaavgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqky
    phlqviggnvvtaaqaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeya
    rrfgvpiiadggiqtvghvvkalalgastvmmgsllaatteapgekgsiqkfvpyliagi
    qhgcqdigarslsvlrsmmysgelkfekrtmsaqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jcnB (B:)
    madylisggtgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkit
    lktplisspmdtvteadmaiamalmggigfihhnctpefqanevrkvknfeqgfitdpvv
    lspshtvgdvleakmrhgfsgipitetgtmgsklvgivtsrdidflaekdhttllsevmt
    prielvvapagvtlkeaneilqrskkgklpivndcdelvaiiartdlkknrdyplaskds
    qkqllcgaavgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqkyphlqvi
    ggnvvtaaqaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeyarrfgvp
    iiadggiqtvghvvkalalgastvmmgsllaatteapgeyffsdgvrlkkyrgmgsldam
    ekssssqkryfsegdkvkiaqgvsgsiqdkgsiqkfvpyliagiqhgcqdigarslsvlr
    smmysgelkfekrtmsaqieggvhglhsyekrly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jcnB (B:)
    tgyvpedgltaqqlfasaddltyndflilpgfidfiadevdltsaltrkitlktplissp
    mdtvteadmaiamalmggigfihhnctpefqanevrkvknfeqgfitdpvvlspgipite
    vgivtsrdidprielvvapagvtlkeaneilqrskkgklpivndcdelvrtdlkknrdyp
    laskdsqkqllcgaavgtreddkyrldlltqagvdvivldssqgnsvyqiamvhyikqky
    phlqviggnvvtaaqaknlidagvdglrvgmgcgsicitqevmacgrpqgtavykvaeya
    rrfgvpiiadggiqtvghvvkalalgastvmmgsllaatteapgekgsiqkfvpyliagi
    qhgcqdigarslsvlrsmmysgelkfekrtmsaqi