PDB entry 1jcj

View 1jcj on RCSB PDB site
Description: observation of covalent intermediates in an enzyme mechanism at atomic resolution
Class: lyase
Keywords: alpha-beta TIM barrel, LYASE
Deposited on 2001-06-09, released 2001-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.142
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribose-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6L0 (1-End)
      • cloning artifact (0)
      • engineered (201)
    Domains in SCOPe 2.06: d1jcja1, d1jcja2
  • Chain 'B':
    Compound: deoxyribose-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6L0 (1-End)
      • cloning artifact (0)
      • engineered (201)
    Domains in SCOPe 2.06: d1jcjb1, d1jcjb2
  • Heterogens: HPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jcjA (A:)
    hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
    lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
    dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
    esarimmevirdmgvektvgflpaggvrtaedaqkylaiadelfgadwadarhyrfgass
    llasllkalghgdgksassy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jcjA (A:)
    hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
    lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
    dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
    esarimmevirdmgvektvgflpaggvrtaedaqkylaiadelfgadwadarhyrfgass
    llasllkalghg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jcjB (B:)
    hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
    lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
    dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
    esarimmevirdmgvektvgflpaggvrtaedaqkylaiadelfgadwadarhyrfgass
    llasllkalghgdgksassy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jcjB (B:)
    hmtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarkt
    lkeqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgf
    dlvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatp
    esarimmevirdmgvektvgflpaggvrtaedaqkylaiadelfgadwadarhyrfgass
    llasllkalgh