PDB entry 1jci

View 1jci on RCSB PDB site
Description: Stabilization of the Engineered Cation-binding Loop in Cytochrome c Peroxidase (CcP)
Class: oxidoreductase
Keywords: Cation-binding loop, Trp191 cationic radical, open/closed conformer, OXIDOREDUCTASE
Deposited on 2001-06-09, released 2002-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.158
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: OPBYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-293)
      • engineered (175)
      • engineered (191)
      • engineered (193)
      • see remark 999 (194)
      • engineered (198)
      • engineered (200)
    Domains in SCOPe 2.06: d1jcia_
  • Heterogens: K, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jciA (A:)
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahtlgkt
hlknsgyegpwtanpnvfdnsfylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl