PDB entry 1jch

View 1jch on RCSB PDB site
Description: Crystal Structure of Colicin E3 in Complex with its Immunity Protein
Class: ribosome inhibitor, hydrolase
Keywords: translocation domain is a beta-jellyroll, the receptor-binding domain is a coiled coil, the RNAse domain is a six-stranded antiparallel beta-sheet. the immunity protein is a four-stranded antiparallel beta sheet flanked by 3 helices on one side of the sheet, ribosome inhibitor, hydrolase
Deposited on 2001-06-09, released 2001-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: 0.237
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Colicin E3
    Species: ESCHERICHIA COLI [TaxId:316407]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00646 (Start-550)
      • conflict (259-260)
    Domains in SCOPe 2.07: d1jcha1, d1jcha2, d1jcha3
  • Chain 'B':
    Compound: Colicin E3 immunity protein
    Species: ESCHERICHIA COLI [TaxId:316407]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jchb_
  • Chain 'C':
    Compound: Colicin E3
    Species: ESCHERICHIA COLI [TaxId:316407]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00646 (Start-550)
      • conflict (259-260)
    Domains in SCOPe 2.07: d1jchc1, d1jchc2, d1jchc3
  • Chain 'D':
    Compound: Colicin E3 immunity protein
    Species: ESCHERICHIA COLI [TaxId:316407]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jchd_
  • Heterogens: CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jchA (A:)
    msggdgrghntgahstsgninggptglgvgggasdgsgwssennpwgggsgsgihwgggs
    ghgngggngnsgggsgtggnlsavaapvafgfpalstpgagglavsisagalsaaiadim
    aalkgpfkfglwgvalygvlpsqiakddpnmmskivtslpadditespvsslpldkatvn
    vnvrvvddvkderqnisvvsgvpmsvpvvdakpterpgvftasipgapvlnisvnnstpa
    vqtlspgvtnntdkdvrpafgtqggntrdavirfpkdsghnavyvsvsdvlspdqvkqrq
    deenrrqqewdathpveaaernyeraraelnqanedvarnqerqakavqvynsrkselda
    anktladaiaeikqfnrfahdpmagghrmwqmaglkaqraqtdvnnkqaafdaaakeksd
    adaalssamesrkkkedkkrsaennlndeknkprkgfkdyghdyhpapktenikglgdlk
    pgipktpkqngggkrkrwtgdkgrkiyewdsqhgelegyrasdgqhlgsfdpktgnqlkg
    pdpkrnikkyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jchA (A:)
    vaapvafgfpalstpgagglavsisagalsaaiadimaalkgpfkfglwgvalygvlpsq
    iakddpnmmskivtslpadditespvsslpldkatvnvnvrvvddvkderqnisvvsgvp
    msvpvvdakpterpgvftasipgapvlnisvnnstpavqtlspgvtnntdkdvrpafgtq
    ggntrdavirfpkdsghnavyvsvsdvlspdqvkqrqdeenrrqqewdathpveaaerny
    eraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqfnrfahdpm
    agghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalssamesrkkkedkkrsae
    nnlndeknkprkgfkdyghdyhpapktenikglgdlkpgipktpkqngggkrkrwtgdkg
    rkiyewdsqhgelegyrasdgqhlgsfdpktgnqlkgpdpkrnikkyl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jchB (B:)
    glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
    yfnhqidisdneyfvsfdyrdgdw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jchC (C:)
    msggdgrghntgahstsgninggptglgvgggasdgsgwssennpwgggsgsgihwgggs
    ghgngggngnsgggsgtggnlsavaapvafgfpalstpgagglavsisagalsaaiadim
    aalkgpfkfglwgvalygvlpsqiakddpnmmskivtslpadditespvsslpldkatvn
    vnvrvvddvkderqnisvvsgvpmsvpvvdakpterpgvftasipgapvlnisvnnstpa
    vqtlspgvtnntdkdvrpafgtqggntrdavirfpkdsghnavyvsvsdvlspdqvkqrq
    deenrrqqewdathpveaaernyeraraelnqanedvarnqerqakavqvynsrkselda
    anktladaiaeikqfnrfahdpmagghrmwqmaglkaqraqtdvnnkqaafdaaakeksd
    adaalssamesrkkkedkkrsaennlndeknkprkgfkdyghdyhpapktenikglgdlk
    pgipktpkqngggkrkrwtgdkgrkiyewdsqhgelegyrasdgqhlgsfdpktgnqlkg
    pdpkrnikkyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jchC (C:)
    vaapvafgfpalstpgagglavsisagalsaaiadimaalkgpfkfglwgvalygvlpsq
    iakddpnmmskivtslpadditespvsslpldkatvnvnvrvvddvkderqnisvvsgvp
    msvpvvdakpterpgvftasipgapvlnisvnnstpavqtlspgvtnntdkdvrpafgtq
    ggntrdavirfpkdsghnavyvsvsdvlspdqvkqrqdeenrrqqewdathpveaaerny
    eraraelnqanedvarnqerqakavqvynsrkseldaanktladaiaeikqfnrfahdpm
    agghrmwqmaglkaqraqtdvnnkqaafdaaakeksdadaalssamesrkkkedkkrsae
    nnlndeknkprkgfkdyghdyhpapktenikglgdlkpgipktpkqngggkrkrwtgdkg
    rkiyewdsqhgelegyrasdgqhlgsfdpktgnqlkgpdpkrnikkyl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jchD (D:)
    glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
    yfnhqidisdneyfvsfdyrdgdw